Sunday, 29 July 2012

SYRIA calling for FREEDOM

Bismillahirrahmanirrahim.
Assalamualaikum..





“Kemesraan, kasih sayang, dan saling berbelas kasihan antara orang-orang beriman diibaratkan seperti satu jasad; apabila satu anggota mengadu kesakitan seluruh jasad akan turut serta berjaga malam serta merasa panas dan gelisah.”

[ Riwayat al-Bukhari dan Muslim ]






" adakah kita PEDULI ??? "



Selepas pembunuhan saudara kita di Palestin, penyembelihan beramai-ramai umat Islam di Haulah, Syria, dan terkini kita digemparkan dengan pembunuhan di Rohingya, Myanmar. 
masih tidak sedarkah kita?



 “Barangsiapa yang tidak mengambil peduli umat Islam yang lain, dia bukan dari golonganku”
[H.R At-Tabrani]







Adakah kita masih mahu berseronok?atau tidak endah dengan isu ini?di mana hati mu yang engkau sembunyikan?di mana sifat kasih sayangmu yang selama ini kau pamerkan?

kenapa diam?



 "Adakah hati kamu tidak bergelora melihat kekejaman yang berlaku terhadap kami sehingga tiada satu kaum pun yang bangkit menyatakan kemarahan kerana Allah?"
(Allahyarham Syeikh Ahmad Yasin-Ketua & Pengasas Hamas)


 
http://3.bp.blogspot.com/-DPhxSaHwKy0/T9qs7kC4T_I/AAAAAAAAAvc/ftpgumzXJRg/s1600/576669_158511524281638_2017777660_n.jpg



  PUISI UNTUKMU, SYRIA

Saudara-saudara Islamku di Syria,
Hatiku bersama hatimu
Jantungku berdegup bersama jantungmu
Aqidahku bersama aqidahmu

Tuhan kita hanya SATU… Allah!
Nabi untuk kita hanya satu…Muhammad s.a.w

Akhawatmu akhawatku
Ikhwanmu ikhwanku
Anak-anak lelakimu, anak-anak lelakiku
Anak-anak perempuanmu, anak-anak perempuanku
Ibubapa kamu, ibubapaku

Kita adalah satu jasad
Kita adalah satu ummah
Perjuangan kita hanya satu
Membebaskan bumi ini dari para taghut
Menyebar keadilan ke seluruh benua
Kutangisi pemergianmu

Namun

Aku berbangga
Sekaligus…
Aku cemburu
Menyaksikan impian Rasulullah s.a.w yang tidak tercapai
Dianugerahkan Allah buatmu
Itulah SYAHID.

Ya Allah,
Ampunilah segala dosa kami
Maafkanlah segala kelemahan kami
Dalam mentaatiMu

Ummu Abbas
1.26pm
21 Rabi’ul Awwal 1433H
Melbourne 


   

"I can't do anything, I wish I could do something, as I watched my brothers and sisters suffering.
Oh Allah..I don't know what should I do,please help them to overcome this adversity,
only You understand what they are going through.

Pray..pray and pray...at least,only that we can do now..don't forget them in your du'a.."






FREEDOM FOR ALL MUSLIMS OF THE WORLD
ALLAHU AKBAR!













Tembakan doa buat Syria
sasarkan peluru berpandu ukhuwah

Ketika Cahaya Ilahi Bersinar ~

Bismillahirrahmanirrahim.
Assalamualaikum !


 ^_^



" Dan milik Allah lah timur dan barat.Maka ke mana pun kamu menghadap,di situlah wajah Allah.Sesungguhnya Allah Maha Luas(rahmat-Nya) lagi Maha Mengetahui. "

[ Surah al-Baqarah 2:115 ]



 



" Allah adalah cahaya langit dan bumi.

Perumpamaan cahaya Allah adalah seperti sebuah lubang yang tak tembus,yang di dalamnya ada pelita besar.

Pelita itu di dalam kaca dan kaca itu seakan-akan bintang seperti mutiara,yang dinyalakan dengan minyak dari pohon yang banyak berkahnya,

iaitu pohon zaitun yang tumbuh tidak di sebelah timur dan tidak pula di sebelah barat,

yang minyaknya saja hampir menerangi walaupun tidak disentuh api.

Cahaya di atas cahaya,Allah membimbing kepada Cahaya-Nya siapa yang Dia kehendaki.

Dan Allah memperbuat perumpamaan-perumpamaan bagi manusia.

Allah Maha Mengetahui segala sesuatu. "


[ Surah al-Nur 24:35 ]




Tertunduk malu
Hati berbunga
menghayati Al-Quran
ini kalam Allah!
ayat ini dari Allah,bagaimana aku tidak jatuh hati?
"Ya Allah,ku mahu cahaya dari-Mu"

*senyum*

 

Thursday, 26 July 2012

My best day !

Bismillahhirrahmanirrahim.
Assalamualaikum wbt.. ^_^








simplyhasanah:

Ameen ya rabbal ‘alameen! :’)
 







Ya Allah




izinkanku




bertemu





dengan-Mu





di








SYURGA-MU.

 

Wednesday, 25 July 2012

Syria Care !

Bismillahhirrahmanirrahim.
Assalamualaikum wbt.




 



Budak Syria ini tabah dan sangat tenang dalam hidupnya, saya mengkagumi tahap keimanannya. Boleh saksikan di youtube kalau terror Bahasa Arab. Ini terjemahannya.

Beliau ditanya bagaimana kecederaan yang dialami beliau dengan kehilangan kedua belah tangan, buta sebelah mata kiri dan cedera pada bahagian perut.

Ditanya: “Bagaimana kamu menguruskan diri kamu?”

Budak ini menjawab: ”Aku tidak berkata kecuali Al-Hamdulillah”.

Sambungnya lagi: "Keadaan aku lebih baik dari orang lain. Aku masih mempunyai sepasang kaki, ada orang lain yang kehilangan tangan dan kaki.

Aku takkan mengeluh aku bimbang kufur pada Allah. Kedua-dua tanganku telah masuk Syurga, jadi aku tak perlu merasa sedih..

Permohonan aku kepada rakyat Kuwait, 'Doakan kemenangan kami... bantulah kami...'

Allah kurniakan aku empat anggota (tangan dan kaki) lalu dia mengambil dua tanganku dan Allah kurniakan aku sepasang mata dan dia ambil satu daripadanya dan dikekalkan satu lagi untuk aku melihat KEMENANGAN...”

MasyaALLAH! Mantap hatinya dan teguh sungguh jawapan orang muda ini.
 



# jangan kita hanya berdiam diri seolah lumpuh jasad dan roh!tidakkah kita melihat?setidaknya berdoalah untuk mereka agar kemenangan dapat dicapai.ayuh,berdoa sahabatku!Syria Care,Muslim Care!

Duhai Syria

Bismillahirrahmanirrahim.
Assalamualaikum wbt.   = '(








  :: DUHAI SYRIA ::



Sedang kami menikmati musik Kpop, RnB, Balada, dan Rock,
kalian didendangkan dengan ledakan bom, herdikan musuh, tangisan anak, dan teriakan takbir pejuang.




Sedang kami bermalasan di atas katil melayan FB, menonton anime, dan mengupdate blog,
kalian pula sedang terbaring menahan pedih tembakan tentera Bashar, ada yang kaku menjadi syahid, tidak kurang yang putus anggota tubuh.



Aduhai Syria...
Ke mana hilangnya sensitiviti kami untuk kalian? Kenapa kami tidak mendengar tangisan kalian? Sampai bila kami berterusan hanyut tanpa peduli keperitan kalian? Kumohon kepada 'kami' yang sedang membaca, jentik relung hati kita agar terpercik sinar kesedaran untuk saudara kita di sana. Kumohon.


"Dahulu rakyat Syria bertungkus-lumus menghulur bantuan kemanusiaan kepada kami. Kini, tibalah masanya untuk kami (rakyat Palestin) membalas jasa mereka dengan mengumpul dana kewangan untuk rakyat Syria yang ditindas oleh rejim Bashar (walaupun kami serba kekurangan).

Pesan kami kepada rakyat Malaysia, andainya kalian tidak dapat menyumbang bantuan dari segi kewangan dan tenaga kepada saudara kita di Syria, cukuplah sekadar kalian mendoakan kesejahteraan mereka. "

p/s: Petikan dari Ceramah Syria Berdarah dan Bahaya Syiah oleh Syria Care: Pertubuhan Penyayang Islam Membantu Syria.



untuk lebih jelas sila klik:boleh beri sumbangan ada no.akaun di situ.




Buktikan kita PEDULI !!!

 

Friday, 20 July 2012

Bahagia Ramadhan Tiba!

Bismillahirrahmanirrahim.
Assalamualaikum wbt. ^_^








# Moga dapat khatam bacaan Al-Quran dan terjemahannya Ramadhan kali ini,InsyaAllah... ^_^
jom..sama2 khatam Al-Quran.jagan gopoh,cuba fahami maksud kalam Allah ini juga dan amalkan,Insya-Allah.. [peringatan buat diri ini semestinya.]


 



like a dream come true

Bismillahirrahmanirrahim.
Assalamualaikum wbt. ^_^







"Bahagia..."


"Ya,itu yang terdetik di hati bila mana terlihat wanita berpurdah/berniqab."


"sejuk dan damai terasa di hati"


Tapi mata ini tak mampu untuk bertentangan mata dengan si pemakai niqab itu

apatah lagi

ingin senyum dan memberi salam kepadanya.

terasa debu-debu dosa pada diri ini menjadi batas untuk melihat mereka

bertentangan mata.


saya tertanya-tanya bagaimana sesetengah kaum adam dengan sewenangnya melihat mereka?
I wonder why???


pernah sekali saya bertembung dengan wanita berpurdah di pasar raya di kampungku

dia muda lagi,dia bersama dengan umminya.


bila bertembung,saya sangat ingin senyum kepadanya
 "niqabi maksudku.."

lantas,saya senyum.

tidak ku sangka dia membalas senyuman meskipun terlindung di bawah kain kecil itu

saya tahu itu daripada senyuman matanya yang sepet

apabila dia membalas senyumanku.

^_^
 niqabi yang comel!~


 Do you not find them very beautiful???
I do...

precious!


I feel like as if I wanted to be like these beautiful women.
my dream.

 [sesetengah manusia menyangka mereka memakai niqab kerana terpaksa ataupun sekadar nak show off yang mereka ni seorang "alim".]

tapi saya tak rasa statement di atas ni benar.

 sebaliknya,mereka berniqab kerana nak rasa lebih dekat dengan Allah.


" to be closer to Allah SWT "


bukannya maksudku kalau tak pakai purdah tak boleh dekat dengan Allah

tapi

dengan berniqab ni kita akan lebih berjaga-jaga

"jaga daripada melakukan dosa"

dengan cara mereka tersendiri,niqab.

itu sangat jelas!

Maafkan saya jika salah,saya bukan siapa2
cuma miliki iman senipis kulit bawang

dan impikan untuk menjadi

seorang muslimah yang lebihhh BAIK!


" They want to remind themselves that they are not only women, but they are also muslims."



saya tak tahu..

kenapa saya rasa sangat malu bila berada di kalangan mereka.

niqabi sangat cantik dan berharga!


sometimes wonder what if I were like them? What would happen when I wear a purdah? More importantly, WHY and WHEN am I going to wear?


what my mak and abah going to say?



saya tak tahu.



Allah lebih mengetahui segalanya tentang saya.

Moga dipermudahkan-Nya

seandainya suatu saat nanti

saya-juga-begitu

Insya-Allah...



"musim luruh merindui musim bunga ditaman larangan"

hiperbola tahap putus fius,haha.. =D



 " I am willing to accept it, as long as I can be near to His Almighty. "



so..can i wear it?

hehe..~



pernah saya tanya mak saya.makcakaptakpayahlapakainiqab,tenguktuorangyangdalambidangagamapuntakpakainiqab.

perasaansangatsedih.tapisayatahusayatakselayakitulagi.sayakenagalibanyak2ilmuagama.


tapi niat kena lah betul.







kerana ALLAH.






buat masa terdekat ni mungkin tidak lagi.


who knows?

mungkin tahun depan?

kenapa IPTA tak bagi pakai purdah??


jika ia benar berlaku dengan izin ALLAH,

sekelip mata saya



Bertukar!



ninja muslimah.

heh...maaf,gurau je.



 " niqab is like a dream come true for me "

precious!





Tuesday, 17 July 2012

Angry Birds dan Dakwah Islamiyah?

Bismillahirrahmanirrahim.
Assalamualaikum wbt. ^_^


 


Angry Birds Apa yang best sangat game ni? Cam simple je, game berkaitan burung-burung yang marah kepada babi-babi berwarna hijau yang mencuri telur mereka.

Sedar tak kita…

Jawapannya sebab….
..dipenuhi dengan nilai-nilai dan prinsip-prinsip sebuah gerakan Dakwah Islamiyah

1) Jihad dan Tadhiyyah (Pengorbanan)
Antara ciri yang paling power pasal Angry Birds ni, sebab burung-burung yang marah tu semuanya sanggup berkorban; menyerahkan jiwa dan tubuh mereka untuk mencapai matlamat mereka iaitu menghapuskan babi-babi hijau yang suka tersengih jika masih hidup di akhir permainan. Mungkin yang merah, biru dan hijau hanya sanggup mencederakan diri sendiri.

Tapi bagaimana dengan yang hitam dan putih? Yang hitam sanggup meletupkan dirinya sendiri! Yang putih pula? Sanggup mengorbankan anaknya!

Itu bukanlah satu pengorbanan yang senang; menghantar anak yang masih dalam telur ke medan jihad. Segala-galanya untuk mencapai satu matlamat; menjatuhkan tembok-tembok jahiliyah yang kukuh, untuk menghapuskan babi-babi hijau itu selama-lamanya… terutamanya ketua mereka yang memakai mahkota emas.

“Sesungguhnya Allah membeli dari orang-orang mukmin itu diri mereka dan harta mereka dengan memberikan kepada mereka syurga…” (At-Taubah 9:110)

2) Amal Jamaie
Dalam nak meruntuhkan tembok-tembok jahiliyah yang begitu kukuh, burung-burung yang marah itu tidak bertindak secara berseorangan, malahan mereka tidak akan mampu meruntuhkannya jika bertindak secara berseorangan. Maka mereka bersatu, bersatu tenaga mereka, bertindak secara berjemaah untuk meruntuhkan tembok-tembok jahiliyah itu.

3) Tanzim (organisasi)
Yang tersusun tapi adakah diorang main langgar je sape yang serang dulu?

Tidak. Diorang sedar setiap burung mempunyai kemampuan dan semangat pengorbanan yang berbeza. Setiap burung mempunyai isti’ab (penguasaan) yang berbeza. Jadi diorang susun, sape pergi dulu, lepas tu sape pergi dulu.

Kenapa? Sebab Saidina Ali mengatakan:

“Kebatilan yang tersusun akan mengalahkan kebenaran yang tidak tersusun”

4) Gerak kerja yang Muntijah (berhasil)
Bagaimana pula cara diorang susun sape yang pergi dulu dan sape yang pergi dulu?

Diorang susun dengan menilai, bagaimanakah cara yang paling muntij dan cepat untuk meruntuhkan tembok jahiliyah itu? Maka setiap orang yang mempunyai isti’ab yang berbeza, berfokus kepada kelebihannya.

Yang reti potong kayu pergi serang kayu
Yang boleh hancurkan batu pergi hancurkan batu

Dan menjadi tanggungjawab kita pula, sebagai qiyadah (ketua) mereka, untuk detect, apakah kelemahan musuh kita, dan dengan segala kekuatan serta isti’ab jundi (tentera) yang berbeza-beza.

Bagaimanakah kita ingin menyusun strategi untuk mencapai ustaziyatul alam?

“eh silap”

Untuk mengalahkan babi-babi hijau tadi dengan tenaga yang paling sikit, dan masa yang paling cepat.

5) Taat
Dan sebagai qiyadah, perkara yang paling menyenangkan hati kita dan meneruskan semangat kita untuk berjuang, adalah kalau kita suruh burung-burung marah itu menyerang ke atas, maka dia akan pergi ke atas, dan kalau ke kanan, maka dia akan pergi ke kanan.

Pasti tidak ada orang yang nak main, dan selama-lamanya babi-babi hijau itu akan gelak terkekeh-kekeh, jika qiyadah suruh serang ke kanan, dia pergi melayang ke atas.

6) Ukhuwah
Lastly, kena faham, bahawa ukhwah burung-burung yang marah itu sangat kuat, itulah teras dan tunjang utama kekuatan diorang, mereka sedih, marah, apabila saudara-saudara mereka dicuri telurnya, mereka merasai penderitaan saudara-saudara mereka.

Kerana sesungguhnya burung-burung yang berwarna itu bersaudara, seperti mana kita umat Islam bersaudara.

Jika salah satu daripada saudara kita sakit/derita, kita turut merasakan penderitaannya. Dan kita akan berusaha untuk menyelamatkan saudara kita, daripada musuh yang nampak di dunia, dan juga musuh yang tidak nampak, yang menarik kita ke api neraka.

Kenapa? Sebab kita menyayangi saudara kita, sesungguhnya dakwah ikhwanul muslimin itu adalah berteraskan dakwah kasih sayang. Kerana cinta kita kepada Islam dan Umat Islam, tidak akan wujud game Angry Birds, jika tidak ada ukhwah di kalangan mereka.

Begitu juga tidak akan wujud gerakan Islam, malahan mustahil akan menang gerakan Islam, jika tidak wujud ukhwah dan muhibbah antara semua umat Islam.

“Apabila telah datang pertolongan Allah dan kemenangan. Dan engkau melihat manusia berbondong-bondong memasuki agama Allah. Maka bertasbihlah dengan memuji Tuhanmu dan mohonlah ampunan kepadaNya. Sungguh, Dia Maha Penerima Taubat” (An-Nasr 110:1-3)

Sedarlah. Pertolongan Allah tidak akan datang jika tidak wujud ukhwah dan kesatuan di kalangan umat Islam dan prinsip kepada kesatuan itu terletak pada Usul 20 oleh Imam Hassan Al-Banna.

Semua yang korang baca tadi adalah pengajaran daripada Angry Birds.

Tapi ada satu lagi pengajaran yang tersirat, iaitu jika kita melihat dunia ini dengan perspektif Islam yang jernih, kita akan memasuki sebuah dunia yang berbeza, dan kita akan mampu melihat apakah masalah umat Islam sebenarnya, sehingga mereka tidak mampu menang-menang lagi sampai sekarang..[Ibnu Batoota]


Friday, 13 July 2012

Muslimah jadilah seperti "bidadari besi"

Bismillahirrahmanirrahim.
Assalamualaikum wbt. ^_^




 



 Nasihat dari the real Imam Muda. Ustaz Zakuan a.k.a Ibnu Batoota yang dah merantau ke segenap pelosok dunia berdakwah walaupun umurnya masih remaja.

------
Nasihat beliau buat semua Muslimat:-

"Adakah muslimah-muslimah zaman sekarang sudah hilang semangat jihadnya?

Sudah hilang kekuatan hati?

Sudah hilang ketabahannya?

Bukan aku nak suruh perempuan-perempuan Islam jadi ganas, cuma aku terfikir bila terbaca kisah-kisah sahabiah, mereka lemah lembut tapi sangat kental, hati sekuat besi waja, tak mudah cair dengan lelaki ajnabi (bukan mahram), tak meleleh-leleh bila cakap pasal cinta, tak tergedik-gedik bila lelaki cuit.

Maka aku pun mengambil langkah untuk jadikan facebook ku sebagai malaikat maut bagi kaum Hawa, untuk mentarbiah hati mereka agar kuat, kental dan tabah!

Kalau hari-hari aku bagi status meleleh-leleh, cinta kerana Allah, lelaki soleh untnk perempuan solehah, cinta itu fitrah, carilah suami soleh dan benda-benda leleh yg lain...

"Muslimah yang terhasil nanti macam mana?"

Walaupun ( di fb & realiti ) bertudung, berpurdah, bertudung labuh, ikut usrah, ikut masturat;

Tapi cuit sikit, dah tergedik-gedik...
Ngurat sikit, dah sangkut....
Ajak couple sikit, terus setuju...
Lepas tu, putus cinta,meleleh2...
Ada masalah sikit, doa nak mati..
Kena marah dengan mak/ayah sikit, buat status cakap tak pernah bahagia...
Exam failed, kata taknak hidup lagi...
Pakwe tak mesej sehari, di status penuh dengan kata-kata rindu...
Pakwe marah sikit, buat status meleleh macam haram...

Fikir secara waras, adakah ini sifat wanita yg ditarbiah oleh Rasulullah SAW ketika zaman Baginda SAW?

Nama Saidatina Fatimah, Aisyah, Khadijah, Safiyyah, Ummu Salamah, Ummu Habibah, Sumayyah, Ummu Darda', Masyitah, Balqis, Maryam dan ramai lagi diagung-agungkan kalian. Tapi apa kalian kenal siapa mereka? Bagaimana hebat dan kentalnya hati mereka? Ikut sikap dan akhlak mereka?

Memang akal kalian senipis rambut, tapi kalian bukan BODOH...

Aku datang sebagai pengetuk kepala kalian untuk bangun dari tidur, untuk sedarkan kalian supaya jangan jadi bodoh, jangan jadi hamba lelaki, jangan jadi hamba cinta haram, jangan jadi perempuan murahan, jangan kapel free2 macam bohsia, jangan dok bermanja dengan lelaki macam perempuan tiada harga...

Nabi SAW telah bersabda mafhumnya (au kama qaal), jika seorang lelaki mendapat wanita solehah sebagai isteri, maka separuh agamanya telah sempurna...

Apa kalian sedar 'kesolehahan' kalian itu harganya separuh dari agama?

note: "Ada mata dan telinga kan semua?"





# Ya Allah,jadikan lah aku seorang muslimah seperti mawar agama yang tidak mudah disentuh.Bunga idaman agama!yang memperjuangkan kebenaran agamaku.Aku mahu kelopakku indah tanpa sedikitpun kotoran..Jadikan aku wanita solehah, wanita mukminah~InsyaAllah.

bakal bergelar mahasiswi,InsyaAllah

Bismillahirrahmanirrahim..
Assalamualaikum wbt. ^_^





" Penantian tak berarti sia-sia
Saat perjalanan adalah pencarian diri ."


InsyaAllah ini yang terbaik buatku yang telah Allah tetapkan buatku.

Bila kita telah berusaha,maka seterusnya bertawakal lah kepada-Nya yang berhak kita sandarkan kepercayaan.Allah...

DIA lebih tahu mana yang terbaik buat hambaNYA.percayalah sahabatku! ^_^
bersangka baiklah atas setiap ujian dan pemberian daripada-Nya.



Oleh itu maka (tetapkanlah kepercayaanmu) bahawa sesungguhnya setiap kesukaran disertai kemudahan. (Sekali lagi ditegaskan) Bahawa sesungguhnya setiap kesukaran disertai kemudahan (Al-Insyirah: 5-6)


Kita tidak tahu apakah pilihan kita itu adalah yang terbaik,hanya Allah Yang Maha Mengetahui.

maka bersyukurlah atas pemberian daripada-Nya.Alhamdulillah..

"....Demi sesungguhnya! Jika kamu bersyukur nescaya Aku akan tambahkan nikmatKu kepada kamu..."(Surah Ibrahim: 7)




"Kejayaan Itu Satu Ujian Selain Nikmat Manakala Kegagalan Itu Juga Satu Nikmat Selain Ujian"


 


*peringatan buat diri ini juga kerana aku bukan siapa2 imanku juga adakalanya naik dan turun*

Hanya kepada Allah aku bergantung.

dambakan kasih sayang daripada tuhanku,Allah.

  Apabila kita redha dengan sesuatu perkara yang mengecewakan hati kita, maka percayalah bahawa Allah akan mengantikan kekecewaan itu dengan sesuatu yang tidak dijangka.


lebih kurang dua bulan lagi bakal bergelar mahasiswi.












# Biarpun keputusan UPU ni tak termasuk dalam 8 pilihan ku.Alhamdulillah,segalanya dalam pengetahuan Allah jika ini yang terbaik buatku,aku terima Ya Allah.Terima Kasih...  ^_^

Thursday, 12 July 2012

Terima Kasih Allah dan sujud syukur kepada-Nya

Bismillahirrahmanirrahim.
Assalamualaikum wbt. ^_^




 




1) PENGERTIAN SUJUD SYUKUR
Sujud syukur dari segi syarak ialah suatu sujud (sujud terima kasih) yang dilakukan oleh seseorang ketika mendapat nikmat atau terhindar dari bencana.
Perkataan syukur merupakan kata terbitan daripada perkataan ( ) yang bernaksud penga-kuan ke atas kebaikan yang diberikan kepada seseorang. Terjemahan dalam Bahasa Melayu ialah ucapan terina kasih.

Sebagaimana firman Allah SWT:


Ertinya :

"……………………….Dan sesiapa yang bersyukur, maka sesungguhnya faedahnya itu hanya terpulang kepada dirinya sendiri, (tetapi) sesiapa yang kufur ( tidak bersyukur)(maka tidaklah menjadi hal kepada Allah) kerana sesungguhnya Allah itu Maha Kaya lagi Maha Terpuji.
(Surah Luqman : 12)
Ayat ini menjelaskan kepada kita bahawa seorang hamba yang mendapat nikmat atau terhindar daripada suatu kecelakaan atau dengan erti kata lain ianya boleh dianggap sebagai kesan nikmat. Kesan nikmat akan nampak dan terlaksana dalam kehidupan seorang insan menerusi lisan (perkataan), hati (perasaan) dan perbuatan. Ertinya ketika seorang hamba itu menerima nikmat daripada Allah SWT, atau mendapat berita yang menggembirakan, maka lisannya akan berikrardan sedar bahawa nikmat yang ia dapat itu dating daripada Allah SWT. Maka, hendaklah ia bersyukur sambil mengucap Alhamdulillah memuji-muji Allah SWT. Manakala hatinya akan menjadi lapang, tenteram, damai serta sejahtera, mengakui dengan kebaikan-kebaikan yang telah diterima tersebut. Dengan demikian, kesan nikmat itu akan mengubah tingkah lakunya untuk sentiasa melaksanakan perkara-perkara yang diredhai Allah SWT. 

Sebagaimana hadis Nabi yang diriwayatkan oleh Abu Daud dan Tirmizi:
Ertinya :
"Dari Abu Bakrah r.a.Bahawasanya Nabi s.a.w. apabila telah datang kepadanya suatu urusan yang menyenangkan atau beliau gembira kerana sesuatu, beliau sujud ke tanah sebagai berterima kasih kepada Allah SWT."
( Diriwayatkan oleh Abu Daud dan Tirmizi)
Abdurrahman bin 'Auf menceritakan bahawa suatu ketika beliau melihat Nabi SAW mengadap kiblat iaitu bersujud dengan sujud yang panjang sehingga kata Abdurrahman bin 'Auf : "Aku menyangka bahawa Allah telah mencabut nyawa baginda ketika itu. Lalu aku mendekati baginda dan duduk disisi baginda. Maka baginda mengangkat kepalanya dan berkata: Siapa ini? Abdurrahman, jawabku.. Baginda bertanya lagi: Apa kamu buat di sini? Aku menjawab: Wahai utusan Allah tuan telah bersujud dengan suatu sujud yang mengkhawatirkan aku kalau-kalau Allah telah mencabut nyawa tuan di dalam sujud tersebut, maka baginda berkata: Sesungguhnya Jibril 'alaihissalam tadi dating kepadaku dan menggembirakan aku, katanya:

Sebagaimana hadis Nabi yang diriwayatkan oleh Abu Daud dan Tirmizi:

Ertinya :
Ertinya :
"Diriwayatkan oleh Ahmad dari hadis Abdurrahman Ibn "Auf (ra) bahawasanya Jibril berkata kepada Nabi SAW : Allah Taala berfirman : Sesiapa yang bersalawat ke atas kamu, aku (Allah Taala) akan berselawat ke atasnya dan sesiapa memberikan salam kepada kamu, Aku ( Allah Taala) akan memberikan salam kepadanya."

 


Selain daripada itu banyak riwayat yang menceritakan bahawa ramai diantara para sahabat yang melakukan sujud syukur seperti:
Abu Bakar al-Siddiq. Beliau bersujud syukur ketika mendengar khabar terbunuhnya Musailamah al-Kazzab dalam pertempuran menumpas kaum murtad di Bandar al-Yamamah.
Ali binAbi Talib bersujud syukur ketika mendapati bahawa Za'al al-Tsadyah diantara orang-orang yang terbunuh dikumpulan al-Khawarij.
Imam Bukhari meriwayatkan bahawa Ka'ab bin Malik telah bersujud ketika sampai kepadanya berita bahawa Allah telah menerima taubatnya.
Disini dapatlah dikatakan bahawa sikap syukur itu lebih merupakan suatu tindakbalas seorang hamba ketika ciberikan suatu nikmat oleh Allah SWT atau mendapat berita yang menggembirakan atau terhindar dari bahaya kepada suatu amalan yang sifatnya ketaatan kepada Allah.

2) SEBAB-SEBAB SUJUD SYUKUR
Secara umumnya sujud syukur itu dilakukan apabila seorang hamba itu mendapat nikmat atau terhindar dari suatu bencana atau mendapatkan kembali sesuatu yang telah hilang atau selamat dari merbahaya.
Dalam hal ini hokum sujud syukur menurut mazhab Syafii dan Hanbali adalah sunat, sama ada nikmat yang diperolehi atau bencana yang dialami itu khas bagi dirinya atau am bagi semua umat Islam, seperti kemenangan ke atas musuh, hilangnya wabak yang merbahaya dan sebagainya. Tetapi terdapat suatu pandangan dikalangan mazhab Hanbali bahawa sujud syukur hanya dilakukan bagi nikmat yang sifatnya umum untuk semua umat Islam dan bukan untuk nikmat yang khas.

3) SYARAT-SYARAT SUJUD SYUKUR

Menurut mazhab Syafi'e dan Hanbali disyaratkan sepertimana hendak melakukan solat iaitu thaharah, suci daripada hadas kecil ataupun besar, mengadap kiblat dan menutup aurat.
 

4) KAIFIAT SUJUD SYUKUR
Cara pelaksanaanya adalah sebagai berikut:
1) Mengadap kiblat
2) Bertakbir kemudian sujud sekali dengan membaca doa sepertimana doa sujud di dalam solat.
3) Bertakbir sekali lagi untuk bangkit daripada sujud, kemudian salam tanpa membaca doa tasyahud.
(untuk salam boleh dilakukan sekali)

5) HUKUM SUJUD SYUKUR DI DALAM SOLAT
Menurut mazhab Syafi'e dan Hanbali bahawa sujud syukur tidak dibenarkan dilakukan di dalm solat kerana ianya termasuk dalam katogeri sujud di luar solat. Apabila dikerjakan maka solatnya dianggap batal kecuali dalam keadaan jahil atau lupa.

6) HUKUM SUJUD SYUKUR PADA WAKTU YANG DILARANG
MENGERJAKAN SOLAT

Makruh hukumnya mengerjakan sujud Syukur pada waktu-waktu yang dilarang mengerjakan solat sunat seperti selepas solat Subuh atau selepas solat Asar. Meskipun pada ketika itu berlaku sebab-sebab yang membolehkan mengerjakan solat sunat. Begitu juga tidak dibenarkan mengerjakan sujud syukur ketika mendengar khutbah Jumaat. 


7) RUKUN SUJUD SYUKUR
1) Berniat untuk sujud syukur
2) Membaca takbiratul ihram ketika hendak sujud
3) Satu kali sujud
4) Memberi salam sesudah sujud

8) PENUTUP

Mudah-mudahan akan dapat sama-sama laksanakan sujud syukur ini dalam kehidupan kita seharian sebagai salah satu lambang ketaatan dan kesyukuran kita kepada Allah SWT, pemberi rezeki.


sumber

# Alhamdulillah..terima kasih Ya Allah..hari ni result UPU dah keluar,Alhamdulillah hajat nak melanjutkan pelajaran di Universiti tercapai.Aku bersyukur pada-Mu Ya Razzaq.Aku yakin apa yang telah engkau tetapkan buat diriku itulah yang terbaik buatku.UNIMAP~InsyaAllah.


 

Terus cintai Al-Quran dan semat di hati

Bismillahirrahmanirrahim.
Assalamualaikum wbt. ^_^





The successful ones are those who attach themselves to the Qur'an!






" The Love Letter".



"This is the Book; in it guidance sure, without doubt; to those who fear Allah." (Al-Baqarah:2)


 niawardhani:

Love this Al-Qur’an with rainbow motif. This is owned by Dian Pelangi.






 Andai suatu hari, sedang sibuk kita membelek-belek buku di perpustakaan, tiba-tiba di tengah-tengah helaian buku kita terselit satu surat cinta daripada orang yang kita suka. Apakah perasaan kita ketika itu? Adakah kita akan membaca surat itu dengan sekadar baca sambil membuat muka ketat tiada perasaan ataupun bersungguh-sungguh membacanya sehingga menangis-nangis ataupun tersenyum sehingga ke telinga. (aku bukan menyuruh korang menghantar surat cinta, sekadar contoh)

Bagaimanakah pula dengan keadaan kita ketika membaca ayat-ayat cinta dari Allah SWT? Sahabat-sahabat dahulu menangis teresak-esak ketika membaca al Quran kerana takut dengan azab yang Allah janjikan buat mereka yang kufur. Ketika orang-orang kafir Quraish mendengar ayat-ayat Quran yang dibacakan oleh rasulullah, mereka juga tahu untuk berasa takut sehingga berkata, " Cukup-cukup ya Rasulullah, kami tahu ajaran yang dibawa oleh engkau itu benar, namun ini adalah agama adat resam nenek moyang kami, kami harus pertahankannya."

Sedangkan kita membaca ayat-ayat cinta Allah tanpa punya sedikit perasaan kerana apa? kerana al Quran itu di dalam bahasa arab dan ramai yang tidak mengetahui maksud sebenar ayat yang dibaca. Itulah gunanya al Quran terjemahan. Rugilah kita kerana kita tidak tahu bagaimana mahu berinteraksi dengan al Quran. Seolah-olah kita suka mendapat surat cinta dari orang yang kita suka tetapi satu reaksi apa pun tidak dapat kita berikan.

Buat penggemar-penggemar novel, mereka akan membaca novel itu dengan sepenuh hati, sehinggakan mencurah-curah air mata ketika membaca babak sedih. Jikalau mereka membaca buku anatomy, mereka akan menggunakan sepenuh akal mereka untuk mengingat sebetul-betulnya di manakah origin , insertion, elevation, action muscles yang ada pada anggota badan. Begitu juga adanya manusia yang membaca al Quran dengan akal, hanya ingin mencari kaitan Islam dan sains. Bacalah al Quran itu dengan hati.


 
 SEANDAINYA AL QURAN MAMPU BERBICARA  
"Aku pasti ada di setiap rumah muslim, tetapi aku pasti tiada di jiwa setiap muslim Aku pasti diletakkan di rak yang tinggi, tetapi aku jarang dibaca Terkadang aku diletak di tempat-tempat yang kotor, kata mereka untuk menghalau jin dan syaitan Aku dikucup selepas dibaca dengan penuh rasa tanda kasih dan hormat, tetapi isiku dilupakan selepas membaca."



 

This Ramadhan let us make a sincere effort to understand what we read of the Qur'aan. Lets keep a translation of the Qur'aan ready with us to check out the meaning of the ayaat as we finish a Juz each day. Lets gain multiple rewards by reading, reciting, understanding, pondering & practicing Allah's beautiful words! Insha Allah! :)





Wednesday, 11 July 2012

Suka buku tahap petala kelapan~

Bismillahhirrahmanirrahim.
Assalamualaikum wbt. ^_^




Tengok tajuk,tak leh blah.aduh!ce sopan sikit ayat tu cik kak oii~tajuk tu ala2 terkena tempias karya Hlovate.Berbalik pada tajuk yang mungkin membuatkan sesetengah pembaca rasa cuak dan senak perut.ye ke?Astaghfirullahhalazim..maaf jika ayat ini membuatkan anda rasa tak selesa.Admin tengah pening2 sikit buat masa ni.putus fius apa~  =.="


aku suka buku.suka kedai buku.suka perpustakaan.suka pesta buku...
taaappiiiii.....kenapa dalam lingkungan waktu menganggur ni rasa liat ja nak habiskan sebuah buku pun seolah-olah kena bermujahadah habis-habisan.ye la...kalau tak syahid depan buku tu ja.alih2 buku tu yang baca kita bukan kita baca buku.ye tak?


Tempat yang banyak buku ni membuatkan aku rasa lain macam.ye lain macam.lain yang macam mana agaknya?entah la macam mana nak dihuraikan dengan kata2.Tapi cukuplah aku cakap yang kalau bila tak de mood nak studi,tempat-tempat macam tu la yang buat diri ni rasa seperti dimotivasikan dengan keadaan buku-buku yang tersusun rapi di sekeliling.pernah rasa macam tu?



Boleh  ke pergi kedai buku,then keluar dengan tangan kosong.isshhh..rasa janggal/pelik.kecuali la kot terlupa bawa duit tak pun buku yang diangankan tak ada kat situ.Rambang mata bila pergi kedai buku.Lagi heaven bila di kedai buku tu tak ramai orang sebab boleh la pusing 2,3 round sambil boleh bedah buku satu persatu.memang puas la tak da gangguan sekeliling,tak de la malu nak tengok2 semua buku kat sana.
Dan disinilah nafsu mula menjerit dan menggila agar dapat menjerat kita dalam perangkapnya.huhu.. =D
Cuma akal dan hati yang bicara memainkan peranan dengan giatnya agar tidak tertipu dek nafsu nak beli buku bebanyakkk..Buku yang tersusun di rumah tu pun tak terbaca lagi.


aduh!kenapa la pantang sungguh pergi kedai buku rasa nak angkut 3kg.parah2... ='(
aku tak layan buku cintan cintun melayu yang kebanyakkannya entah apa-apa.banyak yang lagha daripada dapat kutip ibrah daripadanya.


Baru-baru ni ada pergi kedai buku POPULAR(nama kedai buku) dengan mak dan abah.berangan nak drive sendiri,tapi tak pun.heh..angan je lebih!  ;)
Antara buku-buku yang selamat dimiliki buat tambah koleksi lagi :

1) 5 Tahun,5 Bulan-Hlovate

2) Anda bertanya Ustaz Azhar Idrus(UAI) menjawab berkenaan permasalahan semasa.

3) Komik sains ikhtiar hidup Dunia Virus(tersesat sekali)-Han Hyun Dong.layan komik korea yang dah di terjemah.kenapa la komik ni pula yang tercapai dek tangan.aneh.mungkin sebab mood jadi budak menggangur tak bertauliah.

Tiba2 teringat UPU,tak lama lagi menjelma resultnya.Ya Allah...permudahkanlah urusanku,ku ingin bermujahadah dan menuntut ilmu di Universiti.



Surah Al-'Alaq ayat 1 - 5. [96:1-5]




# Buku/kitab yang paling hebat di dunia ialah love letter from Allah{Al-Quran}.

# Kawan pernah bagi tahu kalau pergi mana2 bawa buku.biar la pandangan orang(bukan niat kita nak riak)sebab bila bosan kan ada buku di tangan yang boleh baca.lepas ni bawa buku bersama-sama *serius*
biar akrab dengan buku,ilmu pun bertambah.boleh amalkan,anda pasti suka.heh... =.=" InsyaAllah..
amaran : jgn buang tabiat bawa buku masuk tandas,buku kan ada ilmu,ilmu tu kan cahaya.agak2 la kalau ye pun~

the beauty one,bring kalamullah together.

Friday, 6 July 2012

...kata2...


# Admin bukanlah seorang yang pandai melukis.tapi suka lukis walaupun huduh lukisannya bila ada mood dengan pen/pensil + kertas. ; )
iye..iye..laaa saaannggaattttt..heh =.="


Thursday, 5 July 2012

Ya "Di Sini" lah!

Bismillahirrahmanirrahim.
Assalamualaikum wbt. ^_^



KMPP.
Di sini aku mengenal suasana biah solehah
Di sini aku berjinak dengan bulatan gembira

Meskipun cuma setahun tempohku belajar di sini
banyak yang telahku coret dalam "buku sejarah" hidupku
tanpa aku sedari..

Di sini aku mengenal lebih mendalam erti persahabatan
Di sini Allah pilih aku untuk melalui ujian-Nya
Di sini aku mengenal pensyarah yang penyayang
+ pensyarah yang ambil berat tentang aku..
pernah pensyarah kimia bagi nasihat peribadi tentang hubungan kita dgn Allah dekat awak?
rasa nak menangis ja bila ingat balik.

Di sini ketabahan dalam diriku lagi bertambah dengan kuasa dua
Di sini bakal aku melakar yang seterusnya
Di sini Allah mengetuk "pintu hatiku"
"pintu hatiku" di sini bukanlah bererti jodoh ya.. =.="
sebaliknya di jalan ini aku tempuh untuk merebut redha dan kasih sayang ilahi

Ya...
Di sinilah segalanya tercatat di Lauh Mahfuzh
"setiap kejadian telah tertulis jelas di dalam Kitab (Lauh Mahfuzh) tidak ada satupun kejadian yang terjadi kebetulan."


Di sini persaingan mula menjengah
Di sini hidup bertambah warna
bagai pelangi selepas hujan
Indah berseri mewarnai alam.. ;)


Di sini aku mengajar diriku agar lebih bersyukur
Di sini mujahadah makin melangkah laju
bersama sahabat..tak kira baru ke lama.
Ya sahabat inilah yang bersamaku di setiap perjuangan.gigih betul!


Ini langkahku~  ^_^

Terus melaju
Ini langkahku
Bangkitkan jihad !!
Pastikan langkahmu wahai pejuang
Dengan Al-Qur'an menjadi pedoman... =)

Di sini pertama kali sambut Ramadhan bersama teman
Di sini jumpa UNIC & Ustzh.Fatimah Syarha secara live
Di sini...aku tertanya-tanya
pernah ntah naik bas rasmi KMPP ni? =.="
rasanya pernah sentuh ja bas tu.hehe..

Di sini aku jumpa qalbu yang dekat dengan surau
Di sini,Surau An-Nur pernah tercatat lembaran sejarah
persahabatan.
Di sini mudah menguntum senyuman pada mawar agama
walaupun hakikatnya diri ini bukanlah seorang yang mudah
peramah
Di sini aku mula cintai tahajjud dan dhuha
kenapa waktu menganggur ni susah sangat nak buat?
perlu mujahadah dan kekentalan hati,ikhlas dlm ibadah
kerana ALLAH..

Di sini mata sepet ini mula bertemankan kaca mata
tapi jarang berkaca mata(power tak kuat)
bila di tanya mengapa?
jawapanku:rasa macam dok dlm akuarium
ketawa sahabat praktikumku berhambur

aduh!sudah mula melalut ni..
lebih baik buat conclusion sblm panjang description.
konklusinya ambil rangkap nasyid Brothers-Selamat Berjuang
persembahkan....

"Slamat berjuang sahabatku
Semoga Allah berkatimu
Kenangan indah bersamamu
Takkan kubiar dia berlalu
Berjuanglah hingga ke akhirnya
Dan ingatlah semua ikrar kita

Hati ini sayu mengenangkan
Sengsara di dalam perjuangan
Jiwa ku merana dan meronta mengharapkan
Kedamaian dan jua ketenangan wo uwo....

Tetapi kuatur pada hakikat
Suka dan duka dalam perjuangan
Perlu ketabahan dan kekuatan
Keteguhan hati berlandaskan iman..."


# cuak rasanya result UPU nak keluar tak lama lagi.dan perlu diingatkan buat diri ini perjuangan wajib di teruskan!ya..wajib!tak kira kat mana pun kita.Berjuanglah hingga keakhirnya!

#kenapa blog rasa lagi lembab load dia,mungkin sebab tukar template.

jgn terkejut dgn kata ganti diri pertama yang digunakan admin.kejap "ana" kejap "aku"